What is IGF-1LR3?
IGF-1LR3 is a research peptide used for laboratory study only.
It is also called Long R3 IGF-1.
First, it is based on human IGF-1.
Then, it is modified at the third amino acid position.
Also, it has a 13-amino-acid extension at the N-terminus.
So, researchers choose IGF-1LR3 for controlled in-vitro work.
It is commonly studied in cell culture models.
However, it is not sold for human use.
It is not a medicine, supplement, or cosmetic product.
At Global Peptides Official, IGF-1LR3 is supplied for research use only.
Therefore, buyers must handle it under proper lab conditions.
Is IGF-1LR3 tested?
Yes. Each batch should be checked with third-party lab testing.
For this product page, the main testing point is Janoshik verification.
Janoshik testing helps confirm batch quality.
Also, it gives researchers clear data before use.
The COA may include purity, mass, and analytical details.
But values can change by batch.
So, always check the latest COA before ordering.
Key feature: Batch-specific Janoshik COA support.
Purity: Enter current batch purity from Janoshik COA.
Recommended listing format: 99%+ Janoshik tested, if confirmed by your COA.
What are the IGF-1LR3 specifications?
| Detail | Information |
|---|---|
| Product name | IGF-1LR3 |
| Other name | Long R3 IGF-1 |
| Research use | Laboratory research only |
| Sequence | MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA |
| Formula | C400H625N111O115S9 |
| Molecular weight | About 9.1 kDa |
| Length | 83 amino acids |
| Form | Lyophilized powder |
| Purity | Batch-specific Janoshik COA |
| Testing | Janoshik lab report available when provided |
| Storage | Store at -20°C |
| Website | https://globalpeptidesofficial.com/ |
How should IGF-1LR3 be stored?
IGF-1LR3 should be stored cold and dry.
First, keep the vial sealed before use.
Next, store it at -20°C.
Also, avoid heat, moisture, and direct light.
Once handled, use clean lab practice.
Do not expose the vial to repeated temperature changes.
However, storage needs may vary by batch.
Therefore, always follow the COA and internal lab protocol.
For long-term storage, keep the lyophilized powder frozen.
For short-term handling, reduce time at room temperature.
Why order IGF-1LR3 Research Peptide from Global Peptides Official?
Researchers want clear product data.
They also want batch support and simple ordering.
Global Peptides Official focuses on research peptides.
So, this IGF-1LR3 listing is built for lab buyers.
The page gives the name, form, formula, storage, and testing details.
Also, Janoshik COA support helps reduce uncertainty.
But researchers should still review every batch document.
Finally, the product is supplied only for research use.
IGF-1LR3 from Global Peptides Official is not for personal use.
It is not for diagnosis, treatment, or prevention.
It is not for food, drug, cosmetic, or veterinary use.
Research Use Only. All products listed on globalpeptidesofficial.com are intended exclusively for in-vitro laboratory research. These compounds are not approved by the FDA or any regulatory authority for human or veterinary use. They are not drugs, supplements, or medical treatments. Nothing on this page constitutes medical advice, diagnosis, or treatment recommendations. Researchers are solely responsible for compliance with applicable local, national, and international regulations governing the purchase, storage, and use of research chemicals.







Reviews
There are no reviews yet.